PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00706.40
Common NameJCGZ_21459, LOC105649561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Dof
Protein Properties Length: 365aa    MW: 40036.3 Da    PI: 8.5596
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00706.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-3966126262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Jcr4S00706.40  66 PQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 126
                    6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.0E-3368124IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2869124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52570124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MLGNCEKMVV ISPTTNEWPQ NHQIDEKSLM PSTSKLMEKR GQELSQPQQL HHQQQQQQQQ  60
QQHQPPQQAL KCPRCDSSNT KFCYYNNYSL SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR  120
KNKRVKRPAS AVEGATTSAS SAANPNNHPS QTPIDISSTS NHSNPLFYGL TANPSEVNLS  180
FPGTFNSRVS SNMDIVSGYD LQPQLNALAL GFSTNNGGFN PSKQIQDVVT SSTSLLSNYS  240
NLFGSSNSLT ATASPTMATL LASSLHQQKF SIKDARAALN HYQSLTSFQD LQMSGNNNES  300
AGIATKEVKI EQDHSRLDWN MPCQNQIDQI GFSSSDPSLY WNTSTSSVGA WHDPGNIGSS  360
VTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6051730.0FJ605173.1 Jatropha curcas putative DOF zinc finger protein (dof2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091630.10.0PREDICTED: dof zinc finger protein DOF1.4 isoform X1
TrEMBLA0A067JDZ70.0A0A067JDZ7_JATCU; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.19e-48Dof family protein
Publications ? help Back to Top
  1. Yang J,Yang MF,Zhang WP,Chen F,Shen SH
    A putative flowering-time-related Dof transcription factor gene, JcDof3, is controlled by the circadian clock in Jatropha curcas.
    Plant Sci., 2011. 181(6): p. 667-74
    [PMID:21958709]
  2. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]